Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF790 Peptide - N-terminal region

ZNF790 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20350, MGC62100

UniProt

Q6PG37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF790 Rabbit Polyclonal Antibody (orb581255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996777

Preservative

Lyophilized powder

AA Sequence

CKNHSLDCLCFRGDWEGNTQFQTLQDNQEECFKQVIRTCEKRPTFNQHTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULt2a3 Mouse Gene Knockout Kit (CRISPR)
KN516968 1 Kit

SULt2a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NSMase2 (SMPD3) (NM_018667) Human Recombinant Protein
TP318441M 100 µg

NSMase2 (SMPD3) (NM_018667) Human Recombinant Protein

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL
BNC402074-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Narcissus pseudonarcissus Lectin (Daffodil) -NPA-,  10nm
GP-8006-10 1 mL

Colloidal Gold Conjugated Narcissus pseudonarcissus Lectin (Daffodil) -NPA-, 10nm

Sign In for Pricing
View Details
Recombinant Human SerpinA3/AACT Protein (His Tag)
PKSH033032-01 10 µg

Recombinant Human SerpinA3/AACT Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SerpinA3/AACT Protein (His Tag)
PKSH033032-02 50 µg

Recombinant Human SerpinA3/AACT Protein (His Tag)

Sign In for Pricing
View Details