Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC5 Peptide - N-terminal region

TRAPPC5, trafficking protein particle complex 5, TRS31; MGC52424; TRAPPC5, trafficking protein particle complex subunit 5, trafficking protein particle complex subunit 5

Product Specifications

Product Name Alternative

MGC52424, TRS31

UniProt

Q8IUR0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_777554

Preservative

Lyophilized powder

AA Sequence

MEARFTRGKSALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQZ23
MBS5800373 Inquire

IQZ23

Sign In for Pricing
View Details
X-Ray Repair Cross Complementing 5 (XRCC5) Antibody
abx331557 100 µL

X-Ray Repair Cross Complementing 5 (XRCC5) Antibody

Sign In for Pricing
View Details
PLAP Antibody, mAb, Rabbit
A05232-50 50 µL

PLAP Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Phospho-SCNN1B (Ser633) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1812944 100 µL

Phospho-SCNN1B (Ser633) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Quick Step Horse Serum amyloid A (SAA) elisa Kit
QS0053Ho-01 48 Tests

Quick Step Horse Serum amyloid A (SAA) elisa Kit

Sign In for Pricing
View Details
Quick Step Horse Serum amyloid A (SAA) elisa Kit
QS0053Ho-02 96 Tests

Quick Step Horse Serum amyloid A (SAA) elisa Kit

Sign In for Pricing
View Details