Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC5 Peptide - N-terminal region

TRAPPC5, trafficking protein particle complex 5, TRS31; MGC52424; TRAPPC5, trafficking protein particle complex subunit 5, trafficking protein particle complex subunit 5

Product Specifications

Product Name Alternative

MGC52424, TRS31

UniProt

Q8IUR0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_777554

Preservative

Lyophilized powder

AA Sequence

MEARFTRGKSALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TB Chaperonin GroEL
Y123185 100 µL

Anti-TB Chaperonin GroEL

Sign In for Pricing
View Details
F37876-0002, Bel-Blotter 96-Well Replicating
1214235 1 Unit

F37876-0002, Bel-Blotter 96-Well Replicating

Sign In for Pricing
View Details
CDK5RAP3 Antibody
MBS7116473-01 0.05 mg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
MBS7116473-02 0.1 mg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
MBS7116473-03 5x 0.1 mg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Wfikkn1 shRNA (UAS) - Lentiviral mouse Wfikkn1 shRNA (UAS) (25)
GTR15238073 1 Vial

Lentiviral mouse Wfikkn1 shRNA (UAS) - Lentiviral mouse Wfikkn1 shRNA (UAS) (25)

Sign In for Pricing
View Details