Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfy2 Peptide - middle region

Zfy2, zinc finger protein 2, Y linked, Zfy-2; Zfy2, zinc finger Y-chromosomal protein 2, zinc finger Y-chromosomal protein 2, Y-linked zinc finger protein 2

Product Specifications

Product Name Alternative

Zfy-2

UniProt

P20662

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033597

Preservative

Lyophilized powder

AA Sequence

VDDVGETIQAVESETDNGNEAEVTDQRTSIHVPRVNIYMLASDSQKEEED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUR-1 Double Nickase Plasmid (h)
sc-401540-NIC 20 µg

SUR-1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
NXF1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1470704 1.0 µg DNA

NXF1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CECR5 Antibody (Center)
E45R06096G-4 50 µL

CECR5 Antibody (Center)

Sign In for Pricing
View Details
2- (Benzyloxy) -4-bromo-1,3-dimethoxybenzene
OR1099491-01 250 mg

2- (Benzyloxy) -4-bromo-1,3-dimethoxybenzene

Sign In for Pricing
View Details
2- (Benzyloxy) -4-bromo-1,3-dimethoxybenzene
OR1099491-02 500 mg

2- (Benzyloxy) -4-bromo-1,3-dimethoxybenzene

Sign In for Pricing
View Details
2- (Benzyloxy) -4-bromo-1,3-dimethoxybenzene
OR1099491-03 1 g

2- (Benzyloxy) -4-bromo-1,3-dimethoxybenzene

Sign In for Pricing
View Details