Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfy2 Peptide - middle region

Zfy2, zinc finger protein 2, Y linked, Zfy-2; Zfy2, zinc finger Y-chromosomal protein 2, zinc finger Y-chromosomal protein 2, Y-linked zinc finger protein 2

Product Specifications

Product Name Alternative

Zfy-2

UniProt

P20662

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033597

Preservative

Lyophilized powder

AA Sequence

VDDVGETIQAVESETDNGNEAEVTDQRTSIHVPRVNIYMLASDSQKEEED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat 6-phosphofructokinase, muscle type, Pfkm ELISA KIT
ELI-02501r 96 Tests

Rat 6-phosphofructokinase, muscle type, Pfkm ELISA KIT

Sign In for Pricing
View Details
Anti-Collagen I antibody
STJ98862 200 µl

Anti-Collagen I antibody

Sign In for Pricing
View Details
GPR103 (QRFPR) (NM_198179) Human Over-expression Lysate
LS084109-20ug 20 µg

GPR103 (QRFPR) (NM_198179) Human Over-expression Lysate

Sign In for Pricing
View Details
I830012O16Rik 3'UTR GFP Stable Cell Line
TU159855 1.0 mL

I830012O16Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
QSOX2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1767204 1.0 µg DNA

QSOX2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
BAIAP2L1 antibody
FNab00794 100 µg

BAIAP2L1 antibody

Sign In for Pricing
View Details