Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cfl2 Peptide - N-terminal region

Cfl2 Peptide - N-terminal region

Product Specifications

UniProt

P45591

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cfl2 Rabbit Polyclonal Antibody (orb330553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031714

Preservative

Lyophilized powder

AA Sequence

FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enbucrilate, Technical Grade
TRC-E555470-25G 25 g

Enbucrilate, Technical Grade

Sign In for Pricing
View Details
PHKG1 (Center) Rabbit Polyclonal Antibody
AP13915PU-N 400 µL

PHKG1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ataxin 3 (ATXN3) (Center) Rabbit Polyclonal Antibody
AP50312PU-N 400 µL

Ataxin 3 (ATXN3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB8B (NM_001145720) Human Over-expression Lysate
LC428984 20 µg

ZBTB8B (NM_001145720) Human Over-expression Lysate

Sign In for Pricing
View Details
(-)-Nefopam Hydrochloride
TRC-N385750-50MG 50 mg

(-)-Nefopam Hydrochloride

Sign In for Pricing
View Details
Cesium Hydroxide Monohydrate
TRC-C280010-50G 50 g

Cesium Hydroxide Monohydrate

Sign In for Pricing
View Details