Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cfl2 Peptide - N-terminal region

Cfl2 Peptide - N-terminal region

Product Specifications

UniProt

P45591

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cfl2 Rabbit Polyclonal Antibody (orb330553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031714

Preservative

Lyophilized powder

AA Sequence

FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL16 Antibody
KC-1552-01 50 μL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-02 100 µL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-03 1 mL

CCL16 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704777 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Disperse Yellow 49
TRC-D494838-2.5MG 2.5 mg

Disperse Yellow 49

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF647 conjugate, 0.1mg/mL
BNC473496-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details