Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nppc Peptide - N-terminal region

Nppc Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNP, MGC130574, lbab

UniProt

Q61839

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nppc Rabbit Polyclonal Antibody (orb583654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_035063

Preservative

Lyophilized powder

AA Sequence

LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB106A (NM_152251) Human Recombinant Protein
TP319477 20 µg

DEFB106A (NM_152251) Human Recombinant Protein

Sign In for Pricing
View Details
EXTL2 Rabbit Polyclonal Antibody
TA362175 100 µL

EXTL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500153 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
TropomoduLin 1 (TMOD1) (NM_001166116) Human Over-expression Lysate
LY431319 100 µg

TropomoduLin 1 (TMOD1) (NM_001166116) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLC25A28 activation kit by CRISPRa
GA113152 1 Kit

Human SLC25A28 activation kit by CRISPRa

Sign In for Pricing
View Details
Stra8 Mouse Gene Knockout Kit (CRISPR)
KN516906 1 Kit

Stra8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details