Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nppc Peptide - N-terminal region

Nppc Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNP, MGC130574, lbab

UniProt

Q61839

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nppc Rabbit Polyclonal Antibody (orb583654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_035063

Preservative

Lyophilized powder

AA Sequence

LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NALF2 Human Gene Knockout Kit (CRISPR)
KN416975 1 Kit

NALF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIRT1 Human Gene Knockout Kit (CRISPR)
KN218134LP 1 Kit

SIRT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI8G6]
CF807180 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI8G6]

Sign In for Pricing
View Details
RAF1 Polyclonal Antibody
E-AB-60020-01 60 µL

RAF1 Polyclonal Antibody

Sign In for Pricing
View Details
RAF1 Polyclonal Antibody
E-AB-60020-02 120 µL

RAF1 Polyclonal Antibody

Sign In for Pricing
View Details
RAF1 Polyclonal Antibody
E-AB-60020-03 200 µL

RAF1 Polyclonal Antibody

Sign In for Pricing
View Details