Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ9 Peptide - C-terminal region

COQ9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf49, DKFZp434K046

UniProt

O75208

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COQ9 Rabbit Polyclonal Antibody (orb585619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_064708

Preservative

Lyophilized powder

AA Sequence

AFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TRUB2 sgRNA gene knockout kit - Lentiviral human TRUB2 sgRNA gene knockout kit (25)
GTR15394806 1 Vial

Lentiviral human TRUB2 sgRNA gene knockout kit - Lentiviral human TRUB2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Tlk2 (NM_001294331) AAV Particle
MR230971A1V 250 µL

Mouse Tlk2 (NM_001294331) AAV Particle

Sign In for Pricing
View Details
SESTD1 Recombinant Protein (Rat)
RP228305 100 µg

SESTD1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Hsa-miR-6784-3p agomir
HY-R02132A-01 5 nmol

Hsa-miR-6784-3p agomir

Sign In for Pricing
View Details
Hsa-miR-6784-3p agomir
HY-R02132A-02 20 nmol

Hsa-miR-6784-3p agomir

Sign In for Pricing
View Details
Camel Tumor Necrosis Factor alpha ELISA Kit
MBS098432-01 48 Well

Camel Tumor Necrosis Factor alpha ELISA Kit

Sign In for Pricing
View Details