Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ9 Peptide - C-terminal region

COQ9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf49, DKFZp434K046

UniProt

O75208

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COQ9 Rabbit Polyclonal Antibody (orb585619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_064708

Preservative

Lyophilized powder

AA Sequence

AFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CDK6 shRNA (UAS) - Lentiviral human CDK6 shRNA (UAS) (25)
GTR15328556 1 Vial

Lentiviral human CDK6 shRNA (UAS) - Lentiviral human CDK6 shRNA (UAS) (25)

Sign In for Pricing
View Details
CD326 Antibody (Low Endotoxin)
GWB-CC720C 0.5 mg

CD326 Antibody (Low Endotoxin)

Sign In for Pricing
View Details
Lentiviral mouse Ccer2 shRNA (UAS) - Lentiviral mouse Ccer2 shRNA (UAS) plasmid
GTR15144055 1 Vial

Lentiviral mouse Ccer2 shRNA (UAS) - Lentiviral mouse Ccer2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-GFP (Green Fluorescent Protein) Antibody
75-414 100 µL

Anti-GFP (Green Fluorescent Protein) Antibody

Sign In for Pricing
View Details
Pigeon Kisspeptin Receptor ELISA Kit
MBS063091 Inquire

Pigeon Kisspeptin Receptor ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ErbB3/Her3 Antibody (SGP1) [DyLight 350]
NB100-2692UV 0.1 mL

Mouse Monoclonal ErbB3/Her3 Antibody (SGP1) [DyLight 350]

Sign In for Pricing
View Details