Slc17a2 Peptide - middle region
Slc17a2 Peptide - middle region
Product Specifications
Product Name Alternative
C730032N17Rik, MGC19073, NPT3, RP23-480B19.3
UniProt
A6PW34
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Slc17a2 Rabbit Polyclonal Antibody (orb574899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659085
Preservative
Lyophilized powder
AA Sequence
GFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740237-500 1x 500 µL
Progesterone (6-5E-10B), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682536-100 1x 100 µL
EZH2 / KMT6 (EZH2/2536), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402847-100 1x 100 µL
Maltose Binding Protein / MBP-probe (R29.6), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682492-100 1x 100 µL
ATG5 (Autophagy Marker) (ATG5/2492), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882590-500 1x 500 µL
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details