Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc17a2 Peptide - middle region

Slc17a2 Peptide - middle region

Product Specifications

Product Name Alternative

C730032N17Rik, MGC19073, NPT3, RP23-480B19.3

UniProt

A6PW34

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc17a2 Rabbit Polyclonal Antibody (orb574899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659085

Preservative

Lyophilized powder

AA Sequence

GFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR3 Recombinant Rabbit Monoclonal Antibody [JA61-33]
ET1704-97 100 µL

CXCR3 Recombinant Rabbit Monoclonal Antibody [JA61-33]

Sign In for Pricing
View Details
Trpc6 Mouse Gene Knockout Kit (CRISPR)
KN318295LP 1 Kit

Trpc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMNDC1 (N-term) Rabbit Polyclonal Antibody
AP53946PU-N 400 µL

SMNDC1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAPPC9 antibody
FNab08950 100 µg

TRAPPC9 antibody

Sign In for Pricing
View Details
INT11 (CPSF3L) Rabbit Polyclonal Antibody
TA365781 100 µL

INT11 (CPSF3L) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Slc30a1 activation kit by CRISPRa
GA204746 1 Kit

Mouse Slc30a1 activation kit by CRISPRa

Sign In for Pricing
View Details