Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4732471D19Rik Peptide - C-terminal region

4732471D19Rik Peptide - C-terminal region

Product Specifications

Product Name Alternative

4732471D19Rik

UniProt

E9Q8U1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Simc1 Rabbit Polyclonal Antibody (orb326051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795961

Preservative

Lyophilized powder

AA Sequence

STSLLKCQSDKTQWQTWDELVEHLQFLLSSYQHVLREHLRSSVIDRKDLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klotho Recombinant Rabbit monoclonal Antibody
HA750445 100 µL

Klotho Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GPR124 Polyclonal Antibody
E-AB-16468-01 20 µL

GPR124 Polyclonal Antibody

Sign In for Pricing
View Details
GPR124 Polyclonal Antibody
E-AB-16468-02 60 µL

GPR124 Polyclonal Antibody

Sign In for Pricing
View Details
GPR124 Polyclonal Antibody
E-AB-16468-03 120 µL

GPR124 Polyclonal Antibody

Sign In for Pricing
View Details
GPR124 Polyclonal Antibody
E-AB-16468-04 200 µL

GPR124 Polyclonal Antibody

Sign In for Pricing
View Details
LIPN (NM_001102469) Human Over-expression Lysate
LY420154 100 µg

LIPN (NM_001102469) Human Over-expression Lysate

Sign In for Pricing
View Details