Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4732471D19Rik Peptide - C-terminal region

4732471D19Rik Peptide - C-terminal region

Product Specifications

Product Name Alternative

4732471D19Rik

UniProt

E9Q8U1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Simc1 Rabbit Polyclonal Antibody (orb326051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795961

Preservative

Lyophilized powder

AA Sequence

STSLLKCQSDKTQWQTWDELVEHLQFLLSSYQHVLREHLRSSVIDRKDLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR561585 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503735 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
MAEA (NM_001297430) Human Tagged ORF Clone
RG237473 10 µg

MAEA (NM_001297430) Human Tagged ORF Clone

Sign In for Pricing
View Details
APC Anti-Human CD133 Antibody[W6B3C1]
E-AB-F1268E-01 20 Tests

APC Anti-Human CD133 Antibody[W6B3C1]

Sign In for Pricing
View Details
APC Anti-Human CD133 Antibody[W6B3C1]
E-AB-F1268E-02 100 Tests

APC Anti-Human CD133 Antibody[W6B3C1]

Sign In for Pricing
View Details
APC Anti-Human CD133 Antibody[W6B3C1]
E-AB-F1268E-03 2x 100 Tests

APC Anti-Human CD133 Antibody[W6B3C1]

Sign In for Pricing
View Details