Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BABAM2 Peptide - C-terminal region

BABAM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRE, BRCC4, BRCC45

UniProt

Q9NXR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BABAM2 Rabbit Polyclonal Antibody (orb585277) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954664

Preservative

Lyophilized powder

AA Sequence

YHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin-α-1 Antibody
8C0121-AAT 50 µg

Actin-α-1 Antibody

Sign In for Pricing
View Details
Accuris 1 Hour Mammalian Genotyping Kit, 400 Reactions
PR1300-MG-400 1 Each

Accuris 1 Hour Mammalian Genotyping Kit, 400 Reactions

Sign In for Pricing
View Details
Neuroglycan C (CSPG5) Rabbit Polyclonal Antibody
AP21148PU-N 100 µg

Neuroglycan C (CSPG5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene A REM
HA110018.5G 5 g

Polystyrene A REM

Sign In for Pricing
View Details
MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP720369L 500 µg

MIG (CXCL9) (NM_002416) Human Recombinant Protein

Sign In for Pricing
View Details
Colloidal Gold Conjugated Lycopersicon esculentum Lectin (Tomato) -LEA-,  20nm
GP-7001-20 1 mL

Colloidal Gold Conjugated Lycopersicon esculentum Lectin (Tomato) -LEA-, 20nm

Sign In for Pricing
View Details