Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC Peptide - C-terminal region

SPARC Peptide - C-terminal region

Product Specifications

Product Name Alternative

ON

UniProt

P09486

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPARC Rabbit Polyclonal Antibody (orb585551) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003109

Preservative

Lyophilized powder

AA Sequence

LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Activation-induced cytidine deaminase, Mouse Anti Human (AICDA Antibody)
PT_75035-01 5 µg

Activation-induced cytidine deaminase, Mouse Anti Human (AICDA Antibody)

Sign In for Pricing
View Details
Activation-induced cytidine deaminase, Mouse Anti Human (AICDA Antibody)
PT_75035-02 20 µg

Activation-induced cytidine deaminase, Mouse Anti Human (AICDA Antibody)

Sign In for Pricing
View Details
Activation-induced cytidine deaminase, Mouse Anti Human (AICDA Antibody)
PT_75035-03 100 µg

Activation-induced cytidine deaminase, Mouse Anti Human (AICDA Antibody)

Sign In for Pricing
View Details
Angiotensin A
HY-110183-01 5 mg

Angiotensin A

Sign In for Pricing
View Details
Angiotensin A
HY-110183-02 10 mg

Angiotensin A

Sign In for Pricing
View Details
Angiotensin A
HY-110183-03 25 mg

Angiotensin A

Sign In for Pricing
View Details