Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC Peptide - C-terminal region

SPARC Peptide - C-terminal region

Product Specifications

Product Name Alternative

ON

UniProt

P09486

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPARC Rabbit Polyclonal Antibody (orb585551) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003109

Preservative

Lyophilized powder

AA Sequence

LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP1 Antibody
DF7130-01 100 µL

IGFBP1 Antibody

Sign In for Pricing
View Details
IGFBP1 Antibody
DF7130-02 200 µL

IGFBP1 Antibody

Sign In for Pricing
View Details
N- (p-Coumaroyl) -L-homoserine lactone
sc-301256 50 mg

N- (p-Coumaroyl) -L-homoserine lactone

Sign In for Pricing
View Details
FAS Blocking Peptide
33R-4455 100 ug

FAS Blocking Peptide

Sign In for Pricing
View Details
OSR1, Phosphorylated (Thr310) (Protein Odd-skipped-related 1, ODD) (Biotin)
MBS6491147-01 0.2 mL

OSR1, Phosphorylated (Thr310) (Protein Odd-skipped-related 1, ODD) (Biotin)

Sign In for Pricing
View Details
OSR1, Phosphorylated (Thr310) (Protein Odd-skipped-related 1, ODD) (Biotin)
MBS6491147-02 5x 0.2 mL

OSR1, Phosphorylated (Thr310) (Protein Odd-skipped-related 1, ODD) (Biotin)

Sign In for Pricing
View Details