CD37 Peptide - middle region
CD37 Peptide - middle region
Product Specifications
Product Name Alternative
GP52-40, MGC120234, TSPAN26
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD37 Rabbit Polyclonal Antibody (orb585703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035120
Preservative
Lyophilized powder
AA Sequence
QDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLA
More Discoveries
Explore Other Products
Browse additional items from our catalog
![GRIN1, glutamate receptor, ionotropic, N-methyl D-aspartate 1, NMDA1, NMDAR1, NR1, N-methyl-D-aspartate receptor channel, subunit zeta-1, NMDA receptor 1, glutamate [NMDA] receptor subunit zeta 1NMDA 1 Receptor, C1 Splice Variant (NMDA R1, N-methyl-D-aspartate) (MaxLight 750) discontinued](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
N2904-ML750 100 µL
GRIN1, glutamate receptor, ionotropic, N-methyl D-aspartate 1, NMDA1, NMDAR1, NR1, N-methyl-D-aspartate receptor channel, subunit zeta-1, NMDA receptor 1, glutamate [NMDA] receptor subunit zeta 1NMDA 1 Receptor, C1 Splice Variant (NMDA R1, N-methyl-D-aspartate) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS7067970 Inquire
Recombinant Cyanothece sp. Protein CrcB homolog (crcB), partial
Sign In for Pricing
View Details 
