CD37 Peptide - middle region
CD37 Peptide - middle region
Product Specifications
Product Name Alternative
GP52-40, MGC120234, TSPAN26
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD37 Rabbit Polyclonal Antibody (orb585703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035120
Preservative
Lyophilized powder
AA Sequence
QDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLA
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3130977-01 48 Tests
Human Anti-LY6K IgG (Lymphocyte antigen 6K Immunoglobulin G) ELISA Kit
Sign In for Pricing
View Details orb3130977-02 96 Tests
Human Anti-LY6K IgG (Lymphocyte antigen 6K Immunoglobulin G) ELISA Kit
Sign In for Pricing
View Details bs-11418R-APC-Cy5.5 100 µL
MC5 Receptor Polyclonal Antibody, APC-Cy5.5 Conjugated
Sign In for Pricing
View Details