Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP3 Peptide - C-terminal region

BMP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BMP-3A

UniProt

P12645

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP3 Rabbit Polyclonal Antibody (orb331243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001192

Preservative

Lyophilized powder

AA Sequence

EKSKNKKKQRKGPHRKSQTLQFDEQTLKKARRKQWIEPRNCARRYLKVDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A3 (ANXA3) Human Gene Knockout Kit (CRISPR)
KN401540 1 Kit

Annexin A3 (ANXA3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS701603 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
SLC36A2 Human Gene Knockout Kit (CRISPR)
KN415739 1 Kit

SLC36A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM76A (NM_001143912) Human Over-expression Lysate
LY428401 100 µg

FAM76A (NM_001143912) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Relaxin (RLN) ELISA Kit
RDR-RLN-Hu-01 96 Tests

Human Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details
Human Relaxin (RLN) ELISA Kit
RDR-RLN-Hu-02 48 Tests

Human Relaxin (RLN) ELISA Kit

Sign In for Pricing
View Details