Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP3 Peptide - C-terminal region

BMP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BMP-3A

UniProt

P12645

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP3 Rabbit Polyclonal Antibody (orb331243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001192

Preservative

Lyophilized powder

AA Sequence

EKSKNKKKQRKGPHRKSQTLQFDEQTLKKARRKQWIEPRNCARRYLKVDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 (Ab-385) Antibody
8B0496-AAT 50 µg

IRF3 (Ab-385) Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-3495-01 50 μL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-3495-02 100 µL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody
KC-3495-03 1 mL

Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Eph receptor B2 (EPHB2) Mouse Monoclonal Antibody [Clone ID: 48CT12.6.4]
AM11064PU-N 200 µL

Eph receptor B2 (EPHB2) Mouse Monoclonal Antibody [Clone ID: 48CT12.6.4]

Sign In for Pricing
View Details
Vegita
TRC-V110000-1MG 1 mg

Vegita

Sign In for Pricing
View Details