Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4 Peptide - N-terminal region

VSIG4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CRIg, Z39IG

UniProt

C9J1L3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VSIG4 Rabbit Polyclonal Antibody (orb578126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171760

Preservative

Lyophilized powder

AA Sequence

PCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA1 pSer310 Rabbit Polyclonal Antibody
AP02342PU-S 50 µL

GATA1 pSer310 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desmocollin 1 (DSC1) (C-term) Rabbit Polyclonal Antibody
AP17996PU-N 400 µL

Desmocollin 1 (DSC1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF420 Rabbit Polyclonal Antibody
TA367396 100 µL

ZNF420 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
liver FABP Recombinant Rabbit Monoclonal Antibody [JE10-77]
HA722321 100 µL

liver FABP Recombinant Rabbit Monoclonal Antibody [JE10-77]

Sign In for Pricing
View Details
Recombinant CCR9 Antibody
RC-16975-01 50 μL

Recombinant CCR9 Antibody

Sign In for Pricing
View Details
Recombinant CCR9 Antibody
RC-16975-02 100 µL

Recombinant CCR9 Antibody

Sign In for Pricing
View Details