0910001L09Rik Peptide - N-terminal region
0910001L09Rik Peptide - N-terminal region
Product Specifications
Product Name Alternative
AV006840, 0910001L09Rik
UniProt
Q8CF66
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lamtor4 Rabbit Polyclonal Antibody (orb325912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001074577
Preservative
Lyophilized powder
AA Sequence
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550525-100 1x 100 µL
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details