Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR1 Peptide - C-terminal region

CFHR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, H36-1, H36-2, HFL1, HFL2, MGC104329

UniProt

Q03591

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFHR1 Rabbit Polyclonal Antibody (orb585282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002104

Preservative

Lyophilized powder

AA Sequence

FGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLI-06 50mg
A13815-50 50 mg

FLI-06 50mg

Sign In for Pricing
View Details
Human PLXNA1 Knockout A549 cell line
GTR15410357 1 Vial

Human PLXNA1 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Phykpl ELISA Kit
EF014179 96 Tests

Mouse Phykpl ELISA Kit

Sign In for Pricing
View Details
Bifendate
S4890-100mg 100 mg

Bifendate

Sign In for Pricing
View Details
TLR10 Rabbit Polyclonal Antibody
orb514664 100 µg

TLR10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STK39 Antibody
MBS9613962-01 0.1 mL

STK39 Antibody

Sign In for Pricing
View Details