Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR1 Peptide - C-terminal region

CFHR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CFHL, CFHL1, CFHL1P, CFHR1P, FHR1, H36-1, H36-2, HFL1, HFL2, MGC104329

UniProt

Q03591

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFHR1 Rabbit Polyclonal Antibody (orb585282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002104

Preservative

Lyophilized powder

AA Sequence

FGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nav1.7 (SCN9A) Mouse Monoclonal Antibody [Clone ID: S68-6]
TA326452 100 µg

Nav1.7 (SCN9A) Mouse Monoclonal Antibody [Clone ID: S68-6]

Sign In for Pricing
View Details
Insl5 Mouse qPCR Primer Pair (NM_011831)
MP206579 200 Reactions

Insl5 Mouse qPCR Primer Pair (NM_011831)

Sign In for Pricing
View Details
Precision Balance (BFU-5618)
BFU-5618 1 Unit

Precision Balance (BFU-5618)

Sign In for Pricing
View Details
TICAM2 Antibody
A48073-50UL 50 μL

TICAM2 Antibody

Sign In for Pricing
View Details
Anti-CLEC14A Antibody Biotin Conjugated
A12642-2-Biotin 100 µg/Vial

Anti-CLEC14A Antibody Biotin Conjugated

Sign In for Pricing
View Details
PRK2 antibody
BF0214 100 µg

PRK2 antibody

Sign In for Pricing
View Details