Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPMT Peptide - C-terminal region

TPMT Peptide - C-terminal region

Product Specifications

UniProt

P51580

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPMT Rabbit Polyclonal Antibody (orb585583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000358

Preservative

Lyophilized powder

AA Sequence

RGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr4 Mouse Gene Knockout Kit (CRISPR)
KN519357 1 Kit

Wdr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TRNT1 activation kit by CRISPRa
GA109559 1 Kit

Human TRNT1 activation kit by CRISPRa

Sign In for Pricing
View Details
Ɑ-Hydroxy-ω-Mercapto PEG
1310000-00-40.1G 1 g

Ɑ-Hydroxy-ω-Mercapto PEG

Sign In for Pricing
View Details
QuantiChrom™ Nitric Oxide Assay Kit
D2NO-100 100 Tests

QuantiChrom™ Nitric Oxide Assay Kit

Sign In for Pricing
View Details
OR51S1 (C-term) Rabbit Polyclonal Antibody
AP53074PU-N 400 µL

OR51S1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDX1 Mouse Monoclonal Antibody [Clone ID: 2g12]
AM06757PU-N 100 µg

PDX1 Mouse Monoclonal Antibody [Clone ID: 2g12]

Sign In for Pricing
View Details