Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPMT Peptide - C-terminal region

TPMT Peptide - C-terminal region

Product Specifications

UniProt

P51580

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPMT Rabbit Polyclonal Antibody (orb585583) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000358

Preservative

Lyophilized powder

AA Sequence

RGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ypel1 (BC049737) Mouse Tagged ORF Clone
MG200212 10 µg

Ypel1 (BC049737) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human Galectin-10 protein (N-His)
PKSH034186-01 20 µg

Recombinant Human Galectin-10 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human Galectin-10 protein (N-His)
PKSH034186-02 100 µg

Recombinant Human Galectin-10 protein (N-His)

Sign In for Pricing
View Details
HES6 Rabbit Polyclonal Antibody
TA377003 100 µL

HES6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C20orf30 (TMEM230) (NM_001009924) Human Over-expression Lysate
LC423152 20 µg

C20orf30 (TMEM230) (NM_001009924) Human Over-expression Lysate

Sign In for Pricing
View Details
CXCL1 / GRO alpha Recombinant Rabbit Monoclonal Antibody [PSH07-53]
HA722841 100 µL

CXCL1 / GRO alpha Recombinant Rabbit Monoclonal Antibody [PSH07-53]

Sign In for Pricing
View Details