Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAG1 Peptide - C-terminal region

PAG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBP, FLJ37858, MGC138364, PAG

UniProt

Q9NWQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAG1 Rabbit Polyclonal Antibody (orb331245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060910

Preservative

Lyophilized powder

AA Sequence

PNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB8B, CT (RAB8B, Ras-related protein Rab-8B) (MaxLight 490)
MBS6339905-01 0.1 mL

RAB8B, CT (RAB8B, Ras-related protein Rab-8B) (MaxLight 490)

Sign In for Pricing
View Details
RAB8B, CT (RAB8B, Ras-related protein Rab-8B) (MaxLight 490)
MBS6339905-02 5x 0.1 mL

RAB8B, CT (RAB8B, Ras-related protein Rab-8B) (MaxLight 490)

Sign In for Pricing
View Details
Dbndd1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3858504 1.0 µg DNA

Dbndd1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ICEBERG CRISPR Activation Plasmid (h2)
sc-417757-ACT-2 20 µg

ICEBERG CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PHLDA1 Antibody
E51A08962 100 µL

PHLDA1 Antibody

Sign In for Pricing
View Details
CDK2/CyclinE1, Unactive recombinant protein
MBS515189-01 0.02 mg

CDK2/CyclinE1, Unactive recombinant protein

Sign In for Pricing
View Details