Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAG1 Peptide - C-terminal region

PAG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CBP, FLJ37858, MGC138364, PAG

UniProt

Q9NWQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAG1 Rabbit Polyclonal Antibody (orb331245) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060910

Preservative

Lyophilized powder

AA Sequence

PNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAA16 sgRNA CRISPR Lentivector (Human) (Target 3)
K2786704 1.0 µg DNA

NAA16 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PGAM1P9 Protein Vector (Human) (pPM-C-His)
PV110617 500 ng

PGAM1P9 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GLT8D1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21636064 1.0 µg DNA

GLT8D1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-HCLS1 (Tyr397) Antibody
A49081-100UL 100 µL

Phospho-HCLS1 (Tyr397) Antibody

Sign In for Pricing
View Details
FOXM1 Antibody - middle region : FITC (ARP39519_P050-FITC)
ARP39519_P050-FITC 100 µL

FOXM1 Antibody - middle region : FITC (ARP39519_P050-FITC)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Glutamate racemase (murI)
MBS1078984-01 0.02 mg (E-Coli)

Recombinant Staphylococcus haemolyticus Glutamate racemase (murI)

Sign In for Pricing
View Details