Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atl2 Peptide - C-terminal region

Atl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2010110I21Rik, AA407293, AV334690, Aip-2, Arl6ip2

UniProt

E9QND8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atl2 Rabbit Polyclonal Antibody (orb580833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835151

Preservative

Lyophilized powder

AA Sequence

KQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ErbB 4/ERBB4 Rabbit Polyclonal Antibody (HRP)
orb2614001 100 µg

ErbB 4/ERBB4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
1-[ (2,6-Difluorophenyl) carbamoyl]cyclopropane-1-carboxylic acid
HIC59417-01 100 mg

1-[ (2,6-Difluorophenyl) carbamoyl]cyclopropane-1-carboxylic acid

Sign In for Pricing
View Details
1-[ (2,6-Difluorophenyl) carbamoyl]cyclopropane-1-carboxylic acid
HIC59417-02 1 g

1-[ (2,6-Difluorophenyl) carbamoyl]cyclopropane-1-carboxylic acid

Sign In for Pricing
View Details
XIRP2 siRNA (Human)
CRJ4999-01 15 nmol

XIRP2 siRNA (Human)

Sign In for Pricing
View Details
XIRP2 siRNA (Human)
CRJ4999-02 30 nmol

XIRP2 siRNA (Human)

Sign In for Pricing
View Details
Triiodothyronine (T3) (AP)
MBS639092-01 50 Units

Triiodothyronine (T3) (AP)

Sign In for Pricing
View Details