Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atl2 Peptide - C-terminal region

Atl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2010110I21Rik, AA407293, AV334690, Aip-2, Arl6ip2

UniProt

E9QND8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atl2 Rabbit Polyclonal Antibody (orb580833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835151

Preservative

Lyophilized powder

AA Sequence

KQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

III Mouse Monoclonal Antibody [Clone ID: E1]
AM05393BT-N 100 µg

III Mouse Monoclonal Antibody [Clone ID: E1]

Sign In for Pricing
View Details
Human GAD1/GAD67 Biotinylated Affinity Purified PAb
BAF2086 50 µg

Human GAD1/GAD67 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
Dithioxamide Solution (Rubeanic Acid Solution) (Reagent for Co, Cu, Fe, Ni)
826310 50 mL

Dithioxamide Solution (Rubeanic Acid Solution) (Reagent for Co, Cu, Fe, Ni)

Sign In for Pricing
View Details
Trim43a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3319105 3x 1.0 µg

Trim43a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SIGLEC15 Adenovirus (Human)
43757051 1.0 mL

SIGLEC15 Adenovirus (Human)

Sign In for Pricing
View Details
Vidutolimod
HY-148511-01 1 mg

Vidutolimod

Sign In for Pricing
View Details