Cdh1 Peptide - C-terminal region
Cdh1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AA960649, Ecad, L-CAM, MGC107495, UVO, Um
UniProt
P09803
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cdh1 Rabbit Polyclonal Antibody (orb584278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033994
Preservative
Lyophilized powder
AA Sequence
SLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R1996-01 50 µg
RGS7 (Regulator of G-Protein Signalling 7) discontinued
Sign In for Pricing
View Details ![NDUFB3 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 3, NADH-Ubiquinone Oxidoreductase B12 Subunit, Complex I-B12, CI-B12) (PE)](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
130224-PE 100 µL
NDUFB3 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 3, NADH-Ubiquinone Oxidoreductase B12 Subunit, Complex I-B12, CI-B12) (PE)
Sign In for Pricing
View Details 
MBS1190530-01 0.05 mg (E-Coli)
Recombinant Kluyveromyces lactis Transcriptional activator HAP3 (HAP3)
Sign In for Pricing
View Details MBS1190530-02 0.05 mg (Yeast)
Recombinant Kluyveromyces lactis Transcriptional activator HAP3 (HAP3)
Sign In for Pricing
View Details MBS1190530-03 0.2 mg (E-Coli)
Recombinant Kluyveromyces lactis Transcriptional activator HAP3 (HAP3)
Sign In for Pricing
View Details MBS1190530-04 0.5 mg (E-Coli)
Recombinant Kluyveromyces lactis Transcriptional activator HAP3 (HAP3)
Sign In for Pricing
View Details