Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdh1 Peptide - C-terminal region

Cdh1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA960649, Ecad, L-CAM, MGC107495, UVO, Um

UniProt

P09803

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdh1 Rabbit Polyclonal Antibody (orb584278) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033994

Preservative

Lyophilized powder

AA Sequence

SLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-01 24 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-02 48 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit
E-EL-R2554-03 96 Tests

Rat CTXII (Cross Linked C-telopeptide of Type II Collagen) ELISA Kit

Sign In for Pricing
View Details
Recombinant Cpn10 Monoclonal Antibody
AN301498L-01 50 µL

Recombinant Cpn10 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Cpn10 Monoclonal Antibody
AN301498L-02 100 µL

Recombinant Cpn10 Monoclonal Antibody

Sign In for Pricing
View Details
HypoGel® 400 Br
SP40011015001.5G 5 g

HypoGel® 400 Br

Sign In for Pricing
View Details