Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSPRY Peptide - C-terminal region

BSPRY Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20150

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BSPRY Rabbit Polyclonal Antibody (orb585316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060158

Preservative

Lyophilized powder

AA Sequence

TEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARP3 Rabbit Polyclonal Antibody (APC-Cy7)
orb1598462 100 µL

ARP3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
RNF144B Peptide
DF4028-BP 1 mg

RNF144B Peptide

Sign In for Pricing
View Details
PANK2 Rabbit Polyclonal Antibody
E28PN2829 100 µL

PANK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) CCME Polyclonal Antibody
MBS7185437 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) CCME Polyclonal Antibody

Sign In for Pricing
View Details
Human MFF Pre-designed siRNA Set A
SI009510A 1 Each

Human MFF Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Myosin Light Chain Kinase (MYLK) ELISA Kit
RDR-MYLK-Hu-01 96 Tests

Human Myosin Light Chain Kinase (MYLK) ELISA Kit

Sign In for Pricing
View Details