Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSPRY Peptide - C-terminal region

BSPRY Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20150

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BSPRY Rabbit Polyclonal Antibody (orb585316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060158

Preservative

Lyophilized powder

AA Sequence

TEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human POLQ Protein
E30P1962 20 µg

Recombinant Human POLQ Protein

Sign In for Pricing
View Details
Rpl23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
41130116 3x 1.0 µg

Rpl23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PLIC-1 Double Nickase Plasmid (m)
sc-425000-NIC 20 µg

PLIC-1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
UTX Lentiviral Activation Particles (h)
sc-402761-LAC 200 µL

UTX Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 27, TTC27 ELISA Kit
MBS9335505-01 48 Well

Human Tetratricopeptide repeat protein 27, TTC27 ELISA Kit

Sign In for Pricing
View Details
Human Tetratricopeptide repeat protein 27, TTC27 ELISA Kit
MBS9335505-02 96 Well

Human Tetratricopeptide repeat protein 27, TTC27 ELISA Kit

Sign In for Pricing
View Details