Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP6 Peptide - C-terminal region

TNFAIP6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TSG-6, TSG6

UniProt

P98066

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFAIP6 Rabbit Polyclonal Antibody (orb585732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009046

Preservative

Lyophilized powder

AA Sequence

DIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKG2D Rabbit Polyclonal Antibody (Biotin)
orb452795 100 µL

NKG2D Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Cxxc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
17223116 3x 1.0 µg

Cxxc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
OAPA00229-5UG - CD45 Antibody
OAPA00229-5UG 5 µg

OAPA00229-5UG - CD45 Antibody

Sign In for Pricing
View Details
IGF2BP2 Mouse Monoclonal Antibody [Clone ID: LBI3G7]
AMM09878VCF 100 µg

IGF2BP2 Mouse Monoclonal Antibody [Clone ID: LBI3G7]

Sign In for Pricing
View Details
Rabbit Anti Human DDAH1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8423623-01 0.12 mL

Rabbit Anti Human DDAH1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human DDAH1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8423623-02 0.2 mL

Rabbit Anti Human DDAH1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details