Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gfm1 Peptide - middle region

Gfm1 Peptide - middle region

Product Specifications

Product Name Alternative

AW545374, D3Wsu133e, Gfm

UniProt

Q8K0D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gfm1 Rabbit Polyclonal Antibody (orb584843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_613057

Preservative

Lyophilized powder

AA Sequence

ISIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nuak1 Pre-designed siRNA Set B
SI109663B 1 Each

Mouse Nuak1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Phospho-SMAD7 (Ser249) Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-20024R-PE-Cy5.5 100 µL

Phospho-SMAD7 (Ser249) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Porcine Corticotropin Releasing Hormone Receptor CRH-R ELISA Kit
BG-POR10463 1 Each

Porcine Corticotropin Releasing Hormone Receptor CRH-R ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal L-Selectin/CD62L Antibody (1009120) [Janelia Fluor 646]
FAB728J 0.1 mL

Mouse Monoclonal L-Selectin/CD62L Antibody (1009120) [Janelia Fluor 646]

Sign In for Pricing
View Details
Ticagrelor Impurity B
CS-O-06350 1 Each

Ticagrelor Impurity B

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 2E1 (CYP2E1)
RPU41131-01 50 µg

Recombinant Rat Cytochrome P450 2E1 (CYP2E1)

Sign In for Pricing
View Details