Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gfm1 Peptide - middle region

Gfm1 Peptide - middle region

Product Specifications

Product Name Alternative

AW545374, D3Wsu133e, Gfm

UniProt

Q8K0D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gfm1 Rabbit Polyclonal Antibody (orb584843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_613057

Preservative

Lyophilized powder

AA Sequence

ISIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD 168568 dihydrochloride
orb1708924-01 5 mg

PD 168568 dihydrochloride

Sign In for Pricing
View Details
PD 168568 dihydrochloride
orb1708924-02 10 mg

PD 168568 dihydrochloride

Sign In for Pricing
View Details
PD 168568 dihydrochloride
orb1708924-03 1 ml x 10 mM (in DMSO)

PD 168568 dihydrochloride

Sign In for Pricing
View Details
PD 168568 dihydrochloride
orb1708924-04 25 mg

PD 168568 dihydrochloride

Sign In for Pricing
View Details
PD 168568 dihydrochloride
orb1708924-05 50 mg

PD 168568 dihydrochloride

Sign In for Pricing
View Details
PD 168568 dihydrochloride
orb1708924-06 100 mg

PD 168568 dihydrochloride

Sign In for Pricing
View Details