Hsp90aa1 Peptide - C-terminal region
Hsp90aa1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4
UniProt
P07901
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hsp90aa1 Rabbit Polyclonal Antibody (orb584942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034610
Preservative
Lyophilized powder
AA Sequence
STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SAPK3 (MAPK12) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10E1]](https://cdn.genprice.uk/products/937/68dd1b64061270361ea13ba4/imageurl/ta500500bm.webp)
TA500500BM 100 µL
SAPK3 (MAPK12) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10E1]
Sign In for Pricing
View Details 
BNC472554-500 1x 500 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682002-100 1x 100 µL
PD1, Mouse (RMP1-14), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
