Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90aa1 Peptide - C-terminal region

Hsp90aa1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4

UniProt

P07901

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsp90aa1 Rabbit Polyclonal Antibody (orb584942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034610

Preservative

Lyophilized powder

AA Sequence

STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4-Cyclohexyl-phenyl)-(4-isopropyl-phenyl)-amine
TRC-C996185-500MG 500 mg

(4-Cyclohexyl-phenyl)-(4-isopropyl-phenyl)-amine

Sign In for Pricing
View Details
UBIAD1 Polyclonal Antibody
E-AB-66069-01 60 µL

UBIAD1 Polyclonal Antibody

Sign In for Pricing
View Details
UBIAD1 Polyclonal Antibody
E-AB-66069-02 120 µL

UBIAD1 Polyclonal Antibody

Sign In for Pricing
View Details
UBIAD1 Polyclonal Antibody
E-AB-66069-03 200 µL

UBIAD1 Polyclonal Antibody

Sign In for Pricing
View Details
Cooled Incubator BICL-6110
BICL-6110 1 Unit

Cooled Incubator BICL-6110

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL
BNC680245-500 1x 500 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details