Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cks1b Peptide - N-terminal region

Cks1b Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410005G18Rik, 2610005D03Rik, AA407784, Cks1, sid1334

UniProt

P61025

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cks1b Rabbit Polyclonal Antibody (orb55717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058600

Preservative

Lyophilized powder

AA Sequence

EFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfsf14 Rabbit Polyclonal Antibody
TA363137 100 µL

Tnfsf14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PITPNB
Y058936 100 µg

Anti-PITPNB

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS706811 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS633208 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
S100B (4C4.9), CF647 conjugate, 0.1mg/mL
BNC470143-500 1x 500 µL

S100B (4C4.9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808818 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details