Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cks1b Peptide - N-terminal region

Cks1b Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410005G18Rik, 2610005D03Rik, AA407784, Cks1, sid1334

UniProt

P61025

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cks1b Rabbit Polyclonal Antibody (orb55717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058600

Preservative

Lyophilized powder

AA Sequence

EFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY1A1 (NM_001130686) Human Over-expression Lysate
LY427240 100 µg

GUCY1A1 (NM_001130686) Human Over-expression Lysate

Sign In for Pricing
View Details
RRM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI17C3]
TA804723AM 100 µL

RRM1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI17C3]

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560648 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
SPEF2 Antibody
KC-26859-01 50 μL

SPEF2 Antibody

Sign In for Pricing
View Details
SPEF2 Antibody
KC-26859-02 100 µL

SPEF2 Antibody

Sign In for Pricing
View Details
SPEF2 Antibody
KC-26859-03 1 mL

SPEF2 Antibody

Sign In for Pricing
View Details