Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD226 Peptide - C-terminal region

CD226 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNAM-1, DNAM1, PTA1, TLiSA1

UniProt

Q15762

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD226 Rabbit Polyclonal Antibody (orb585753) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006557

Preservative

Lyophilized powder

AA Sequence

ISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYRSPISTSQPTNQSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), 1mg/mL
BNUM1547-50 1x 50 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), 1mg/mL

Sign In for Pricing
View Details
Syntenin (SDCBP) (NM_001007067) Human Recombinant Protein
TP312681L 1 mg

Syntenin (SDCBP) (NM_001007067) Human Recombinant Protein

Sign In for Pricing
View Details
FSH Receptor (FSHR) Human Gene Knockout Kit (CRISPR)
KN417736 1 Kit

FSH Receptor (FSHR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SSX2IP Polyclonal Antibody
E-AB-11605-01 20 µL

SSX2IP Polyclonal Antibody

Sign In for Pricing
View Details
SSX2IP Polyclonal Antibody
E-AB-11605-02 60 µL

SSX2IP Polyclonal Antibody

Sign In for Pricing
View Details
SSX2IP Polyclonal Antibody
E-AB-11605-03 120 µL

SSX2IP Polyclonal Antibody

Sign In for Pricing
View Details