Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKAG3 Peptide - N-terminal region

PRKAG3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMPKG3

UniProt

Q9UGI9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKAG3 Rabbit Polyclonal Antibody (orb331259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059127

Preservative

Lyophilized powder

AA Sequence

ENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ABCA13 activation kit by CRISPRa
GA115894 1 Kit

Human ABCA13 activation kit by CRISPRa

Sign In for Pricing
View Details
PPP1A (PPP1CA) (NM_001008709) Human Over-expression Lysate
LY423356 100 µg

PPP1A (PPP1CA) (NM_001008709) Human Over-expression Lysate

Sign In for Pricing
View Details
gag Biotinylated Rabbit Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTIR2C5]
TA700561 50 µg

gag Biotinylated Rabbit Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTIR2C5]

Sign In for Pricing
View Details
CD2 Human Gene Knockout Kit (CRISPR)
KN206612LP 1 Kit

CD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UNC-2170 HCl
SIH-559-5MG 5 mg

UNC-2170 HCl

Sign In for Pricing
View Details
bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody
AP50359PU-N 400 µL

bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details