Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKAG3 Peptide - N-terminal region

PRKAG3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMPKG3

UniProt

Q9UGI9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKAG3 Rabbit Polyclonal Antibody (orb331259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059127

Preservative

Lyophilized powder

AA Sequence

ENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(Diethylamino)azobenzene
TRC-D495010-500MG 500 mg

4-(Diethylamino)azobenzene

Sign In for Pricing
View Details
SMARCA6 (HELLS) Human Gene Knockout Kit (CRISPR)
KN212231 1 Kit

SMARCA6 (HELLS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POLR2H Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF810721 100 µg

POLR2H Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
HINT1 (NM_005340) Human Recombinant Protein
TP303319M 100 µg

HINT1 (NM_005340) Human Recombinant Protein

Sign In for Pricing
View Details