Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13C Peptide - C-terminal region

TNFRSF13C Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAFF-R, BAFFR, CD268, MGC138235, CVID4, BROMIX, prolixin

UniProt

Q96RJ3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFRSF13C Rabbit Polyclonal Antibody (orb585717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443177

Preservative

Lyophilized powder

AA Sequence

PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NORE1 antibody
70R-NR003 100 ug

NORE1 antibody

Sign In for Pricing
View Details
PF-4522654
MBS5814044 Inquire

PF-4522654

Sign In for Pricing
View Details
Rabbit anti-DIXDCl Antibody, Affinity Purified
A304-116A-T 10 µg

Rabbit anti-DIXDCl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit UB ELISA Kit
ERTU0014 96 Tests

Rabbit UB ELISA Kit

Sign In for Pricing
View Details
UNC119 Antibody
63-914 400 µL

UNC119 Antibody

Sign In for Pricing
View Details
RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted) (Biotin) discontinued
R1100-14-Biotin 100 µL

RANTES (Regulated on Activation, Normal T-cell Expressed and Secreted) (Biotin) discontinued

Sign In for Pricing
View Details