Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13C Peptide - C-terminal region

TNFRSF13C Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAFF-R, BAFFR, CD268, MGC138235, CVID4, BROMIX, prolixin

UniProt

Q96RJ3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFRSF13C Rabbit Polyclonal Antibody (orb585717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443177

Preservative

Lyophilized powder

AA Sequence

PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR12 Antibody Picoband® Fluoro488 Conjugated
A07492-1-Fluoro488 100 µg/Vial

Anti-WDR12 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
TLX2 rabbit pAb Antibody
orb2303572-01 50 µL

TLX2 rabbit pAb Antibody

Sign In for Pricing
View Details
TLX2 rabbit pAb Antibody
orb2303572-02 100 µL

TLX2 rabbit pAb Antibody

Sign In for Pricing
View Details
CD32/FcRII-a Mouse mAb, PerCP-Cy7 conjugated
orb2978815 100 µL

CD32/FcRII-a Mouse mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
LINC01561 (NM_001012711) Human Over-expression Lysate
LS404216-100ug 100 µg

LINC01561 (NM_001012711) Human Over-expression Lysate

Sign In for Pricing
View Details
EFHB Polyclonal Antibody
A58902-020 20 µL

EFHB Polyclonal Antibody

Sign In for Pricing
View Details