Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK8IP3 Peptide - N-terminal region

MAPK8IP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp762N1113, FLJ00027, JIP3, JSAP1, KIAA1066, SYD2, syd

UniProt

E9PFH7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK8IP3 Rabbit Polyclonal Antibody (orb585903) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035529

Preservative

Lyophilized powder

AA Sequence

QYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila yakuba Protein teflon (tef), partial
MBS1231754 Inquire

Recombinant Drosophila yakuba Protein teflon (tef), partial

Sign In for Pricing
View Details
Neurofilament M, 160kD (NF-M)
MBS607413-01 1 mL

Neurofilament M, 160kD (NF-M)

Sign In for Pricing
View Details
Neurofilament M, 160kD (NF-M)
MBS607413-02 5x 1 mL

Neurofilament M, 160kD (NF-M)

Sign In for Pricing
View Details
PSMD8 (NM_002812) Human Tagged ORF Clone Lentiviral Particle
RC200436L3V 200 µL

PSMD8 (NM_002812) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (FITC)
MBS6335854-01 0.2 mL

POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (FITC)

Sign In for Pricing
View Details
POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (FITC)
MBS6335854-02 5x 0.2 mL

POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (FITC)

Sign In for Pricing
View Details