Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FPR1 Peptide - middle region

FPR1 Peptide - middle region

Product Specifications

Product Name Alternative

FMLP, FPR

UniProt

P21462

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FPR1 Rabbit Polyclonal Antibody (orb585777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002020

Preservative

Lyophilized powder

AA Sequence

VACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF624 activation kit by CRISPRa
GA111579 1 Kit

Human ZNF624 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse 2B4/CD244 Protein (His Tag)
PKSM041150-01 10 µg

Recombinant Mouse 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse 2B4/CD244 Protein (His Tag)
PKSM041150-02 50 µg

Recombinant Mouse 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details
SAMD14 Human Gene Knockout Kit (CRISPR)
KN421084 1 Kit

SAMD14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmem235 Mouse Gene Knockout Kit (CRISPR)
KN517821 1 Kit

Tmem235 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Netrin G2 Ligand (LRRC4) (C-term) Rabbit Polyclonal Antibody
AP52535PU-N 400 µL

Netrin G2 Ligand (LRRC4) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details